PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN28803.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 490aa    MW: 54784 Da    PI: 6.8493
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN28803.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-16155200147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+++G+ +W++Ia+++  gR++k+c++rw++ 
       KHN28803.1 155 RGHWRPAEDSKLKELVALYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 200
                      899*****************************.***********996 PP

2Myb_DNA-binding55.31.5e-17207250146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l +a++ +G++ W+ Iar ++ gRt++ +k++w+ 
       KHN28803.1 207 RRAFSEEEEERLMQAHRIYGNK-WAMIARLFP-GRTDNAVKNHWHV 250
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.17150201IPR017930Myb domain
SMARTSM007172.9E-14154203IPR001005SANT/Myb domain
PfamPF002491.1E-15155200IPR001005SANT/Myb domain
SuperFamilySSF466891.01E-27155248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-25156208IPR009057Homeodomain-like
CDDcd001674.29E-13158199No hitNo description
PROSITE profilePS5129426.929202256IPR017930Myb domain
SMARTSM007171.8E-14206254IPR001005SANT/Myb domain
PfamPF002493.0E-14207249IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-20209255IPR009057Homeodomain-like
CDDcd001671.28E-11209249No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MKAWPARVIY PSSQENTNSL TRYPSSSSHS SSPPSMGMVY ADMDSLSLCS HYGTVVSSHH  60
QDCYVSNGGT NWGFPFMREC PNNSDDVAEE EEGKGSDSST GEDSDKVNHH ANNSNDESGE  120
DSDKVNHNAN NFNDENSPNE NSNSGGSGHS KLCARGHWRP AEDSKLKELV ALYGPQNWNL  180
IAEKLEGRSG KSCRLRWFNQ LDPRINRRAF SEEEEERLMQ AHRIYGNKWA MIARLFPGRT  240
DNAVKNHWHV IMARKYREQS SAYRRRRLSQ SSSVYRRVDE INTTITTTNS IVVSRDTEQQ  300
APPPPPYCVN LSNNGGLANN IINNNNNINM MSSFPYAAAS FHGVVPSSGG IEFGLNSSPH  360
MTTAKEPFST TKLAPPHIAL YPQQTSLDFF SGVRSSSDMV GEYFGQNLHH QQQQPSSGFY  420
PQYPQYVMLM NHRHQQNNHN NFYGFSNSTS QILLGHKHRD HQNVSSDQCP PDATTTIPPP  480
FIDFLGVGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-331552557107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1262267YRRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556730.10.0PREDICTED: myb-like protein Q
TrEMBLA0A0B2RA440.0A0A0B2RA44_GLYSO; Transcription factor MYB44
STRINGGLYMA20G04511.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.16e-75myb domain protein 105
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]